DLG4 anticorps

N° du produit ABIN632653

Cet anticorps Lapin Polyclonal détecte spécifiquement DLG4 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour DLG4 anticorps (ABIN632653)

Antigène: DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DLG4 anticorps

Purification: Affinity purified

Immunogène: DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLG4 Blocking Peptide, (ABIN936248), is also available for use as a blocking control in assays to test for specificity of this DLG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLG4

Antigène: DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))

Autre désignation: DLG4

Sujet: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Synaptic Membrane, Skeletal Muscle Fiber Development, Asymmetric Protein Localization, Regulation of long-term Neuronal Synaptic Plasticity