DLG4 anticorps
-
- Antigène Voir toutes DLG4 Anticorps
- DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DLG4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS
- Top Product
- Discover our top product DLG4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DLG4 Blocking Peptide, catalog no. 33R-1027, is also available for use as a blocking control in assays to test for specificity of this DLG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))
- Autre désignation
- DLG4 (DLG4 Produits)
- Synonymes
- anticorps 11, anticorps CG1725, anticorps CG1730, anticorps CPD, anticorps DLG, anticorps DLG-A, anticorps Discs-large, anticorps Dlg, anticorps Dlg-A, anticorps Dlg1, anticorps DlgA, anticorps Dmel\\CG1725, anticorps Drodlg, anticorps PSD95, anticorps SAP97, anticorps anon-EST:Posey93, anticorps anon-WO03040301.258, anticorps anon-WO03040301.260, anticorps anon-WO03040301.268, anticorps d. lg.-1, anticorps dlg, anticorps dlg-1, anticorps dlg-A, anticorps dlgA, anticorps dlgS97, anticorps l(1)10Bf, anticorps l(1)G0276, anticorps l(1)G0342, anticorps l(1)G0456, anticorps l(1)G19, anticorps l(1)L11, anticorps l(1)bwn, anticorps l(1)d.lg-1, anticorps l(1)d.lg.-1, anticorps l(1)discs large, anticorps l(1)dlg, anticorps l(1)dlg-1, anticorps l(1)dlg1, anticorps l(1)l.pr.-2, anticorps l(1)lpr-2, anticorps misb, anticorps dlgh4, anticorps psd95, anticorps sap90, anticorps sap-90, anticorps LLGL1, anticorps Dlgh4, anticorps PSD-95, anticorps SAP90, anticorps SAP90A, anticorps Sap90, anticorps SAP-90, anticorps DLG4, anticorps discs large 1, anticorps discs, large homolog 4, anticorps discs large MAGUK scaffold protein 4, anticorps discs, large homolog 4b (Drosophila), anticorps discs, large homolog 4 (Drosophila), anticorps dlg1, anticorps dlg4, anticorps DLG4, anticorps dlg4b, anticorps Dlg4
- Sujet
- This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 85 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Synaptic Membrane, Skeletal Muscle Fiber Development, Asymmetric Protein Localization, Regulation of long-term Neuronal Synaptic Plasticity
-