THAP5 anticorps (Middle Region)

N° du produit ABIN632774

Détail du produit anti-THAP5 anticorps

Antigène: THAP5 (THAP Domain Containing 5 (THAP5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THAP5 est non-conjugé

Application: Western Blotting (WB)

Specificité: THAP5 antibody was raised against the middle region of THAP5

Purification: Affinity purified

Immunogène: THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THAP5 Blocking Peptide, catalog no. 33R-9320, is also available for use as a blocking control in assays to test for specificity of this THAP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THAP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THAP5

Antigène: THAP5 (THAP Domain Containing 5 (THAP5))

Autre désignation: THAP5 (THAP5 Produits)

Synonymes: anticorps THAP domain containing 5, anticorps THAP domain containing 5 S homeolog, anticorps THAP5, anticorps thap5.S

Sujet: THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.

Poids moléculaire: 44 kDa (MW of target protein)