HINT1 anticorps (N-Term)

N° du produit ABIN632794

Cet anticorps Lapin Polyclonal détecte spécifiquement HINT1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour HINT1 anticorps (N-Term) (ABIN632794)

Antigène: HINT1 (Histidine Triad Nucleotide Binding Protein 1 (HINT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HINT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HINT1 anticorps

Épitope: N-Term

Specificité: HINT1 antibody was raised against the N terminal of HINT1

Purification: Affinity purified

Immunogène: HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HINT1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HINT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HINT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HINT1

Antigène: HINT1 (Histidine Triad Nucleotide Binding Protein 1 (HINT1))

Autre désignation: HINT1

Sujet: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

Poids moléculaire: 14 kDa (MW of target protein)