FAM98B anticorps (N-Term)

N° du produit ABIN632835

Cet anticorps anti-FAM98B est un anticorps Lapin Polyclonal détectant FAM98B dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour FAM98B anticorps (N-Term) (ABIN632835)

Antigène: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM98B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM98B anticorps

Épitope: N-Term

Specificité: FAM98 B antibody was raised against the N terminal of FAM98

Purification: Affinity purified

Immunogène: FAM98 B antibody was raised using the N terminal of FAM98 corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM98B Blocking Peptide, (ABIN5613514), is also available for use as a blocking control in assays to test for specificity of this FAM98B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM90 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM98B

Antigène: FAM98B (Family with Sequence Similarity 98, Member B (FAM98B))

Autre désignation: FAM98B

Sujet: The specific function of FAM98B is not yet known.

Poids moléculaire: 45 kDa (MW of target protein)