MAP7D1 anticorps (N-Term)

N° du produit ABIN632935

Détail du produit anti-MAP7D1 anticorps

Antigène: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP7D1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAP7 D1 antibody was raised against the N terminal of MAP7 1

Purification: Affinity purified

Immunogène: MAP7 D1 antibody was raised using the N terminal of MAP7 1 corresponding to a region with amino acids RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAP7D1 Blocking Peptide, catalog no. 33R-8156, is also available for use as a blocking control in assays to test for specificity of this MAP7D1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP7D1

Antigène: MAP7D1 (MAP7 Domain Containing 1 (MAP7D1))

Autre désignation: MAP7D1 (MAP7D1 Produits)

Synonymes: anticorps PARCC1, anticorps RPRC1, anticorps Mtap7d1, anticorps AV028413, anticorps BC019977, anticorps Parcc1, anticorps Rprc1, anticorps mKIAA1187, anticorps zgc:172238, anticorps MAP7 domain containing 1, anticorps MAP7 domain containing 1b, anticorps MAP7D1, anticorps Map7d1, anticorps map7d1b

Sujet: The function of MAP7 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 93 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2