RIC8B anticorps

N° du produit ABIN632939

Détail du produit anti-RIC8B anticorps

Antigène: RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RIC8B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RIC8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RIC8B Blocking Peptide, catalog no. 33R-3821, is also available for use as a blocking control in assays to test for specificity of this RIC8B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RIC8B

Antigène: RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))

Autre désignation: RIC8B (RIC8B Produits)

Synonymes: anticorps DKFZp469H2225, anticorps BC051080, anticorps Ric-8, anticorps Ric-8b, anticorps RIC8, anticorps hSyn, anticorps RIC8 guanine nucleotide exchange factor B, anticorps RIC8B, anticorps Ric8b

Sujet: RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.

Poids moléculaire: 59 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling