PIK3R5 anticorps (N-Term)

N° du produit ABIN632989

Détail du produit anti-PIK3R5 anticorps

Antigène: PIK3R5 (Phosphoinositide-3-Kinase, Regulatory Subunit 5 (PIK3R5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIK3R5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PIK3 R5 antibody was raised against the N terminal of PIK3 5

Purification: Affinity purified

Immunogène: PIK3 R5 antibody was raised using the N terminal of PIK3 5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIK3R5 Blocking Peptide, catalog no. 33R-3839, is also available for use as a blocking control in assays to test for specificity of this PIK3R5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIK3R5

Antigène: PIK3R5 (Phosphoinositide-3-Kinase, Regulatory Subunit 5 (PIK3R5))

Autre désignation: PIK3R5 (PIK3R5 Produits)

Synonymes: anticorps F730038I15Rik, anticorps FOAP-2, anticorps P101-PI3K, anticorps p101, anticorps P101, anticorps RGD1563261, anticorps AV230647, anticorps phosphoinositide-3-kinase regulatory subunit 5, anticorps phosphoinositide-3-kinase regulatory subunit 5 S homeolog, anticorps phosphoinositide-3-kinase, regulatory subunit 5, anticorps PIK3R5, anticorps pik3r5.S, anticorps Pik3r5

Sujet: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Inositol Metabolic Process, Hepatitis C, VEGF Signaling