Tec Protein Tyrosine Kinase (TEC) (Middle Region) anticorps

N° du produit ABIN633042

Cet anticorps anti-Tec Protein Tyrosine Kinase Polyclonal Lapin (ABIN633042) détecte spécifiquement Tec Protein Tyrosine Kinase dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Tec Protein Tyrosine Kinase (TEC) (Middle Region) anticorps (ABIN633042)

Antigène: Tec Protein Tyrosine Kinase (TEC)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: TEC antibody was raised against the middle region of TEC

Purification: Affinity purified

Immunogène: TEC antibody was raised using the middle region of TEC corresponding to a region with amino acids VKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TEC Blocking Peptide, (ABIN5616549), is also available for use as a blocking control in assays to test for specificity of this TEC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Tec Protein Tyrosine Kinase (TEC)

Autre désignation: TEC

Sujet: The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway