PNKP anticorps (N-Term)

N° du produit ABIN633050

L’anticorps Lapin Polyclonal anti-PNKP a été validé pour WB. Il convient pour détecter PNKP dans des échantillons de Humain.

Aperçu rapide pour PNKP anticorps (N-Term) (ABIN633050)

Antigène: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNKP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PNKP anticorps

Épitope: N-Term

Specificité: PNKP antibody was raised against the N terminal of PNKP

Purification: Affinity purified

Immunogène: PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNKP Blocking Peptide, (ABIN5615433), is also available for use as a blocking control in assays to test for specificity of this PNKP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNKP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNKP

Antigène: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Autre désignation: PNKP

Sujet: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Nucleotide Phosphorylation