RABEPK anticorps (N-Term)
-
- Antigène Voir toutes RABEPK Anticorps
- RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RABEPK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RABEPK antibody was raised against the N terminal of RABEPK
- Purification
- Affinity purified
- Immunogène
- RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL
- Top Product
- Discover our top product RABEPK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RABEPK Blocking Peptide, catalog no. 33R-8341, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))
- Autre désignation
- RABEPK (RABEPK Produits)
- Synonymes
- anticorps RAB9P40, anticorps bA65N13.1, anticorps p40, anticorps 8430412M01Rik, anticorps 9530020D24Rik, anticorps AV073337, anticorps C87311, anticorps Rab9p40, anticorps 9530020d24rik, anticorps RGD1310612, anticorps Rab9 effector protein with kelch motifs, anticorps Rab9 effector protein with kelch motifs L homeolog, anticorps RABEPK, anticorps Rabepk, anticorps rabepk.L, anticorps rabepk
- Sujet
- RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.
- Poids moléculaire
- 40 kDa (MW of target protein)
-