CCDC76 anticorps (N-Term)

N° du produit ABIN633095

Détail du produit anti-CCDC76 anticorps

Antigène: CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC76 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC76 antibody was raised against the N terminal of CCDC76

Purification: Affinity purified

Immunogène: CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC76 Blocking Peptide, catalog no. 33R-7618, is also available for use as a blocking control in assays to test for specificity of this CCDC76 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC76 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC76

Antigène: CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))

Autre désignation: CCDC76 (CCDC76 Produits)

Synonymes: anticorps 4631408H19Rik, anticorps A330067P21, anticorps A930028L21Rik, anticorps Ccdc76, anticorps CCDC76, anticorps tRNA methyltransferase 13, anticorps tRNA methyltransferase 13 homolog, anticorps Trmt13, anticorps TRMT13

Sujet: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

Poids moléculaire: 54 kDa (MW of target protein)