MBL2 anticorps (Middle Region)

N° du produit ABIN633169

Détail du produit anti-MBL2 anticorps

Antigène: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MBL2 antibody was raised against the middle region of MBL2

Purification: Affinity purified

Immunogène: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBL2

Antigène: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Autre désignation: MBL2 (MBL2 Produits)

Synonymes: anticorps COLEC1, anticorps HSMBPC, anticorps MBL, anticorps MBL2D, anticorps MBP, anticorps MBP-C, anticorps MBP1, anticorps MBPD, anticorps pMBP-27, anticorps mbl2, anticorps MBL1, anticorps cMBl, anticorps collectin, anticorps Ab2-001, anticorps Ab2-011, anticorps L-MBP, anticorps MBL-C, anticorps COLEC2, anticorps mbl, anticorps etID42583.2, anticorps fb68b07, anticorps hbl3, anticorps wu:fb68b07, anticorps zgc:109836, anticorps mannose binding lectin 2, anticorps Mannose-binding protein C, anticorps mannose-binding lectin (protein C) 2, soluble, anticorps mannose-binding lectin (protein C) 2, anticorps mannose-binding lectin family member 3, pseudogene, anticorps MBL2, anticorps mbl2, anticorps Mbl2, anticorps MBL3P

Sujet: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Système du Complément, Positive Regulation of Immune Effector Process