MBL2 anticorps (Middle Region)

N° du produit ABIN633169

Cet anticorps Lapin Polyclonal détecte spécifiquement MBL2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour MBL2 anticorps (Middle Region) (ABIN633169)

Antigène: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MBL2 anticorps

Épitope: Middle Region

Specificité: MBL2 antibody was raised against the middle region of MBL2

Purification: Affinity purified

Immunogène: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBL2 Blocking Peptide, (ABIN939709), is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBL2

Antigène: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Autre désignation: MBL2

Sujet: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Système du Complément, Positive Regulation of Immune Effector Process