NAA15 anticorps (Middle Region)

N° du produit ABIN633171

Cet anticorps anti-NAA15 est un anticorps Lapin Polyclonal détectant NAA15 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour NAA15 anticorps (Middle Region) (ABIN633171)

Antigène: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAA15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NAA15 anticorps

Épitope: Middle Region

Specificité: NARG1 antibody was raised against the middle region of NARG1

Purification: Affinity purified

Immunogène: NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NARG1 Blocking Peptide, (ABIN5614917), is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAA15

Antigène: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Autre désignation: NARG1

Sujet: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.

Poids moléculaire: 101 kDa (MW of target protein)