CHRNA1 anticorps
-
- Antigène Voir toutes CHRNA1 Anticorps
- CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHRNA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV
- Top Product
- Discover our top product CHRNA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHRNA1 Blocking Peptide, catalog no. 33R-9265, is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))
- Autre désignation
- CHRNA1 (CHRNA1 Produits)
- Synonymes
- anticorps CHRNA1, anticorps ACHRA, anticorps ACHRD, anticorps CHRNA, anticorps CMS2A, anticorps FCCMS, anticorps SCCMS, anticorps NACHRA1, anticorps AI385656, anticorps AI608266, anticorps Achr-1, anticorps Acra, anticorps cholinergic receptor nicotinic alpha 1 subunit, anticorps cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle), anticorps CHRNA1, anticorps Chrna1
- Sujet
- The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-