TMPRSS6 anticorps (N-Term)

N° du produit ABIN633178

Cet anticorps Lapin Polyclonal détecte spécifiquement TMPRSS6 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TMPRSS6 anticorps (N-Term) (ABIN633178)

Antigène: TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMPRSS6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMPRSS6 anticorps

Épitope: N-Term

Specificité: TMPRSS6 antibody was raised against the N terminal of TMPRSS6

Purification: Affinity purified

Immunogène: TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMPRSS6 Blocking Peptide, (ABIN5616699), is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMPRSS6

Antigène: TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))

Autre désignation: TMPRSS6

Sujet: TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis