SLBP anticorps

N° du produit ABIN633212

Détail du produit anti-SLBP anticorps

Antigène: SLBP (Stem-Loop Binding Protein (SLBP))

Reactivité: Humain, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLBP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLBP Blocking Peptide, catalog no. 33R-4084, is also available for use as a blocking control in assays to test for specificity of this SLBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLBP

Antigène: SLBP (Stem-Loop Binding Protein (SLBP))

Autre désignation: SLBP (SLBP Produits)

Synonymes: anticorps CG11886, anticorps Dmel\\CG11886, anticorps SLBP, anticorps dSLBP, anticorps dSLPB, anticorps slbp, anticorps cb157, anticorps sb:cb157, anticorps si:dkey-102m7.2, anticorps GB13630, anticorps HBP, anticorps slbp1, anticorps xslbp, anticorps stem-loop binding protein, anticorps Stem-loop binding protein, anticorps histone RNA hairpin-binding protein, anticorps stem-loop binding protein L homeolog, anticorps Slbp, anticorps slbp, anticorps SLBP, anticorps LOC726745, anticorps EHI_178590, anticorps CpipJ_CPIJ008644, anticorps slbp.L

Sujet: SLBP binds to the stem-loop structure in replication-dependent histone mRNAs. Histone mRNAs do not contain introns or polyadenylation signals, and are processed by endonucleolytic cleavage. The stem-loop structure is essential for efficient processing but this structure also controls the transport, translation and stability of histone mRNAs. Expression of the protein is regulated during the cell cycle, increasing more than 10-fold during the latter part of G1.

Poids moléculaire: 30 kDa (MW of target protein)