PABP anticorps

N° du produit ABIN633226

Cet anticorps Lapin Polyclonal détecte spécifiquement PABP dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PABP anticorps (ABIN633226)

Antigène: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PABP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PABP anticorps

Purification: Affinity purified

Immunogène: PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PABPC1 Blocking Peptide, (ABIN5615183), is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PABP

Antigène: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Autre désignation: PABPC1

Sujet: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome