PABP anticorps

N° du produit ABIN633226

Détail du produit anti-PABP anticorps

Antigène: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PABP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PABP

Antigène: PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))

Autre désignation: PABPC1 (PABPC1 Produits)

Synonymes: anticorps PAB1, anticorps PABP, anticorps PABP1, anticorps PABPC2, anticorps PABPL1, anticorps Pabp1, anticorps PabpI, anticorps Pabpl1, anticorps ePAB, anticorps Pabp, anticorps pab1, anticorps pabp, anticorps pabp1, anticorps pabpc1, anticorps pabpc2, anticorps PABPC1, anticorps wu:fb16a02, anticorps wu:fi19b08, anticorps wu:fj12d09, anticorps wu:fj61f06, anticorps zgc:109879, anticorps zgc:77608, anticorps poly(A) binding protein cytoplasmic 1, anticorps poly(A) binding protein, cytoplasmic 1, anticorps poly(A) binding protein, cytoplasmic 1 S homeolog, anticorps poly(A) binding protein cytoplasmic 1 like, anticorps poly(A) binding protein, cytoplasmic 1 L homeolog, anticorps poly(A) binding protein, cytoplasmic 1a, anticorps poly A binding protein, cytoplasmic 1 b, anticorps PABPC1, anticorps Pabpc1, anticorps pabpc1.S, anticorps pabpc1, anticorps PABPC1L, anticorps pabpc1.L, anticorps pabpc1a, anticorps pabpc1b

Sujet: The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome