PABP anticorps
-
- Antigène Voir toutes PABP (PABPC1) Anticorps
- PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PABP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
- Top Product
- Discover our top product PABPC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PABPC1 Blocking Peptide, catalog no. 33R-5379, is also available for use as a blocking control in assays to test for specificity of this PABPC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PABP (PABPC1) (Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1))
- Autre désignation
- PABPC1 (PABPC1 Produits)
- Synonymes
- anticorps PAB1, anticorps PABP, anticorps PABP1, anticorps PABPC2, anticorps PABPL1, anticorps Pabp1, anticorps PabpI, anticorps Pabpl1, anticorps ePAB, anticorps Pabp, anticorps pab1, anticorps pabp, anticorps pabp1, anticorps pabpc1, anticorps pabpc2, anticorps PABPC1, anticorps wu:fb16a02, anticorps wu:fi19b08, anticorps wu:fj12d09, anticorps wu:fj61f06, anticorps zgc:109879, anticorps zgc:77608, anticorps poly(A) binding protein cytoplasmic 1, anticorps poly(A) binding protein, cytoplasmic 1, anticorps poly(A) binding protein, cytoplasmic 1 S homeolog, anticorps poly(A) binding protein cytoplasmic 1 like, anticorps poly(A) binding protein, cytoplasmic 1 L homeolog, anticorps poly(A) binding protein, cytoplasmic 1a, anticorps poly A binding protein, cytoplasmic 1 b, anticorps PABPC1, anticorps Pabpc1, anticorps pabpc1.S, anticorps pabpc1, anticorps PABPC1L, anticorps pabpc1.L, anticorps pabpc1a, anticorps pabpc1b
- Sujet
- The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation.
- Poids moléculaire
- 71 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-