HNRNPAB anticorps (N-Term)

N° du produit ABIN633238

Cet anticorps Lapin Polyclonal détecte spécifiquement HNRNPAB dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour HNRNPAB anticorps (N-Term) (ABIN633238)

Antigène: HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPAB est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HNRNPAB anticorps

Épitope: N-Term

Specificité: HNRPAB antibody was raised against the N terminal Of Hnrpab

Purification: Affinity purified

Immunogène: HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPAB Blocking Peptide, (ABIN938530), is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPAB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPAB

Antigène: HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))

Autre désignation: HNRPAB

Sujet: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.

Poids moléculaire: 36 kDa (MW of target protein)