HNRNPAB anticorps (N-Term)
-
- Antigène Voir toutes HNRNPAB Anticorps
- HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRNPAB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HNRPAB antibody was raised against the N terminal Of Hnrpab
- Purification
- Affinity purified
- Immunogène
- HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK
- Top Product
- Discover our top product HNRNPAB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNRPAB Blocking Peptide, catalog no. 33R-3144, is also available for use as a blocking control in assays to test for specificity of this HNRPAB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPAB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNRNPAB (Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB))
- Autre désignation
- HNRPAB (HNRNPAB Produits)
- Synonymes
- anticorps fd36h02, anticorps wu:fd36h02, anticorps ABBP1, anticorps HNRPAB, anticorps 3010025C11Rik, anticorps CBF-A, anticorps Cgbfa, anticorps Hnrpab, anticorps A1F-C1, anticorps hm:zeh1271, anticorps hnrpab, anticorps wu:fa18g02, anticorps wu:fb07b06, anticorps wu:fb16c05, anticorps zeh1271, anticorps HNRNP A/B, anticorps heterogeneous nuclear ribonucleoprotein A/Bb, anticorps heterogeneous nuclear ribonucleoprotein A/B, anticorps heterogeneous nuclear ribonucleoprotein A/Ba, anticorps heterogeneous nuclear ribonucleoprotein A/B L homeolog, anticorps hnrnpabb, anticorps hnrnpab, anticorps HNRNPAB, anticorps Hnrnpab, anticorps hnrnpaba, anticorps hnrnpab.L
- Sujet
- This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes.
- Poids moléculaire
- 36 kDa (MW of target protein)
-