SERBP1 anticorps (C-Term)

N° du produit ABIN633268

Cet anticorps Lapin Polyclonal détecte spécifiquement SERBP1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SERBP1 anticorps (C-Term) (ABIN633268)

Antigène: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERBP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SERBP1 anticorps

Épitope: C-Term

Specificité: SERBP1 antibody was raised against the C terminal of SERBP1

Purification: Affinity purified

Immunogène: SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERBP1 Blocking Peptide, (ABIN937524), is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERBP1

Antigène: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Autre désignation: SERBP1

Sujet: SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Poids moléculaire: 45 kDa (MW of target protein)