SERBP1 anticorps (C-Term)

N° du produit ABIN633268

Détail du produit anti-SERBP1 anticorps

Antigène: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SERBP1 antibody was raised against the C terminal of SERBP1

Purification: Affinity purified

Immunogène: SERBP1 antibody was raised using the C terminal of SERBP1 corresponding to a region with amino acids DRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERBP1 Blocking Peptide, catalog no. 33R-2138, is also available for use as a blocking control in assays to test for specificity of this SERBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERBP1

Antigène: SERBP1 (SERPINE1 mRNA Binding Protein 1 (SERBP1))

Autre désignation: SERBP1 (SERBP1 Produits)

Synonymes: anticorps CHD3IP, anticorps HABP4L, anticorps PAI-RBP1, anticorps PAIRBP1, anticorps 1200009K13Rik, anticorps 9330147J08Rik, anticorps AL022786, anticorps Pairbp1, anticorps Pai-Rbp1, anticorps Rda288, anticorps cgi-55, anticorps chd3ip, anticorps habp4l, anticorps pai-rbp1, anticorps pairbp1, anticorps rda288, anticorps hm:zeh0245, anticorps serbp1, anticorps wu:fa12d05, anticorps wu:fb36e07, anticorps wu:fc16f12, anticorps wu:fj13e12, anticorps zgc:55489, anticorps SERPINE1 mRNA binding protein 1, anticorps serpine1 mRNA binding protein 1, anticorps Serpine1 mRNA binding protein 1, anticorps SERPINE1 mRNA binding protein 1 L homeolog, anticorps SERPINE1 mRNA binding protein 1a, anticorps SERBP1, anticorps Serbp1, anticorps serbp1.L, anticorps serbp1a

Sujet: SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Poids moléculaire: 45 kDa (MW of target protein)