ISG20 anticorps (Middle Region)
-
- Antigène Voir toutes ISG20 Anticorps
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ISG20 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ISG20 antibody was raised against the middle region of ISG20
- Purification
- Affinity purified
- Immunogène
- ISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM
- Top Product
- Discover our top product ISG20 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ISG20 Blocking Peptide, catalog no. 33R-9301, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))
- Autre désignation
- ISG20 (ISG20 Produits)
- Synonymes
- anticorps ISG20, anticorps CD25, anticorps HEM45, anticorps 1600023I01Rik, anticorps 2010107M23Rik, anticorps 20kDa, anticorps DnaQL, anticorps interferon stimulated exonuclease gene 20, anticorps interferon-stimulated protein, anticorps ISG20, anticorps Isg20
- Sujet
- ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
- Poids moléculaire
- 20 kDa (MW of target protein)
-