EXOSC2 anticorps (Middle Region)

N° du produit ABIN633278

L’anticorps Lapin Polyclonal anti-EXOSC2 a été validé pour WB. Il convient pour détecter EXOSC2 dans des échantillons de Humain et Souris.

Aperçu rapide pour EXOSC2 anticorps (Middle Region) (ABIN633278)

Antigène: EXOSC2 (Exosome Component 2 (EXOSC2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EXOSC2 anticorps

Épitope: Middle Region

Specificité: EXOSC2 antibody was raised against the middle region of EXOSC2

Purification: Affinity purified

Immunogène: EXOSC2 antibody was raised using the middle region of EXOSC2 corresponding to a region with amino acids AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this EXOSC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC2

Antigène: EXOSC2 (Exosome Component 2 (EXOSC2))

Autre désignation: EXOSC2

Sujet: EXOSC2 belongs to the exosome, a RNA-processing complex, which is at least involved in the 3' processing of the 7S pre-rRNA to the mature 5.8S rRNA. It exhibits a 3'-5' exoribonuclease activity.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome