IMP3 anticorps

N° du produit ABIN633282

Cet anticorps anti-IMP3 Polyclonal Lapin (ABIN633282) détecte spécifiquement IMP3 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour IMP3 anticorps (ABIN633282)

Antigène: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMP3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IMP3 anticorps

Purification: Affinity purified

Immunogène: IMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMP3 Blocking Peptide, (ABIN938704), is also available for use as a blocking control in assays to test for specificity of this IMP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMP3

Antigène: IMP3 (IMP3, U3 Small Nucleolar Ribonucleoprotein (IMP3))

Autre désignation: IMP3

Sujet: This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.

Poids moléculaire: 22 kDa (MW of target protein)