JAKMIP1 anticorps (Middle Region)

N° du produit ABIN633295

Détail du produit anti-JAKMIP1 anticorps

Antigène: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAKMIP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: JAKMIP1 antibody was raised against the middle region of JAKMIP1

Purification: Affinity purified

Immunogène: JAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JAKMIP1 Blocking Peptide, catalog no. 33R-2981, is also available for use as a blocking control in assays to test for specificity of this JAKMIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAKMIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JAKMIP1

Antigène: JAKMIP1 (Janus Kinase and Microtubule Interacting Protein 1 (JAKMIP1))

Autre désignation: JAKMIP1 (JAKMIP1 Produits)

Synonymes: anticorps MGC81051, anticorps Gababrbp, anticorps JAMIP1, anticorps MARLIN1, anticorps 5830437M04Rik, anticorps C330021K24Rik, anticorps Marlin-1, anticorps janus kinase and microtubule interacting protein 1, anticorps janus kinase and microtubule interacting protein 1 L homeolog, anticorps janus kinase and microtubule-interacting protein 1, anticorps Celf_2690, anticorps JAKMIP1, anticorps jakmip1.L, anticorps LOC100070079, anticorps jakmip1, anticorps LOC100432594, anticorps Jakmip1

Sujet: JAKMIP1 associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-B receptor. It may play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome