MIF4GD anticorps (N-Term)

N° du produit ABIN633321

Cet anticorps anti-MIF4GD est un anticorps Lapin Polyclonal détectant MIF4GD dans WB. Adapté pour Humain.

Aperçu rapide pour MIF4GD anticorps (N-Term) (ABIN633321)

Antigène: MIF4GD (MIF4G Domain Containing (MIF4GD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MIF4GD est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MIF4GD anticorps

Épitope: N-Term

Specificité: MIF4 GD antibody was raised against the N terminal of MIF4 D

Purification: Affinity purified

Immunogène: MIF4 GD antibody was raised using the N terminal of MIF4 D corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MIF4GD Blocking Peptide, (ABIN5614769), is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MIF4GD

Antigène: MIF4GD (MIF4G Domain Containing (MIF4GD))

Autre désignation: MIF4GD

Sujet: MIF4GD is a protein which contains an MIF4G domain.

Poids moléculaire: 29 kDa (MW of target protein)