MECOM anticorps (Middle Region)
-
- Antigène Voir toutes MECOM Anticorps
- MECOM (MDS1 and EVI1 Complex Locus (MECOM))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MECOM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EVI1 antibody was raised against the middle region of EVI1
- Purification
- Affinity purified
- Immunogène
- EVI1 antibody was raised using the middle region of EVI1 corresponding to a region with amino acids KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT
- Top Product
- Discover our top product MECOM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EVI1 Blocking Peptide, catalog no. 33R-4417, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MECOM (MDS1 and EVI1 Complex Locus (MECOM))
- Autre désignation
- EVI1 (MECOM Produits)
- Synonymes
- anticorps AML1-EVI-1, anticorps EVI1, anticorps MDS1, anticorps MDS1-EVI1, anticorps PRDM3, anticorps D630039M04Rik, anticorps Evi-1, anticorps Evi1, anticorps Jbo, anticorps Mds, anticorps Mds1, anticorps Mds1-Evi1, anticorps Prdm3, anticorps Znfpr1b1, anticorps evi1, anticorps im:7140716, anticorps prdm3, anticorps evi-1, anticorps mecom, anticorps mecom-a, anticorps mecom-b, anticorps xEvi-1, anticorps evi1-B, anticorps MDS1 and EVI1 complex locus, anticorps MDS1 and EVI1 complex locus L homeolog, anticorps MDS1 and EVI1 complex locus S homeolog, anticorps MECOM, anticorps Mecom, anticorps mecom, anticorps mecom.L, anticorps mecom.S
- Sujet
- EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
- Poids moléculaire
- 118 kDa (MW of target protein)
-