A1CF anticorps (N-Term)

N° du produit ABIN633338

L’anticorps Lapin Polyclonal anti-A1CF a été validé pour WB. Il convient pour détecter A1CF dans des échantillons de Humain.

Aperçu rapide pour A1CF anticorps (N-Term) (ABIN633338)

Antigène: A1CF (APOBEC1 Complementation Factor (A1CF))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A1CF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-A1CF anticorps

Épitope: N-Term

Specificité: A1 CF antibody was raised against the N terminal of A1 F

Purification: Affinity purified

Immunogène: A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A1CF Blocking Peptide, (ABIN937672), is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A1CF

Antigène: A1CF (APOBEC1 Complementation Factor (A1CF))

Autre désignation: A1CF

Sujet: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.

Poids moléculaire: 65 kDa (MW of target protein)