A1CF anticorps (N-Term)

N° du produit ABIN633338

Détail du produit anti-A1CF anticorps

Antigène: A1CF (APOBEC1 Complementation Factor (A1CF))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A1CF est non-conjugé

Application: Western Blotting (WB)

Specificité: A1 CF antibody was raised against the N terminal of A1 F

Purification: Affinity purified

Immunogène: A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A1CF Blocking Peptide, catalog no. 33R-2286, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A1CF

Antigène: A1CF (APOBEC1 Complementation Factor (A1CF))

Autre désignation: A1CF (A1CF Produits)

Synonymes: anticorps ACF, anticorps ACF64, anticorps ACF65, anticorps APOBEC1CF, anticorps ASP, anticorps 1810073H04Rik, anticorps Acf, anticorps A1cft, anticorps Apobec-1, anticorps acf, anticorps acf64, anticorps acf65, anticorps apobec1cf, anticorps asp, anticorps A1CF, anticorps APOBEC1 complementation factor, anticorps apobec1 complementation factor, anticorps APOBEC1 complementation factor L homeolog, anticorps A1CF, anticorps A1cf, anticorps a1cf, anticorps a1cf.L

Sujet: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.

Poids moléculaire: 65 kDa (MW of target protein)