EIF3B anticorps (C-Term)

N° du produit ABIN633340

Cet anticorps Lapin Polyclonal détecte spécifiquement EIF3B dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour EIF3B anticorps (C-Term) (ABIN633340)

Antigène: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF3B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF3B anticorps

Épitope: C-Term

Specificité: EIF3 S9 antibody was raised against the C terminal of EIF3 9

Purification: Affinity purified

Immunogène: EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3S9 Blocking Peptide, (ABIN936200), is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF3B

Antigène: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Autre désignation: EIF3S9

Sujet: EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization