MECOM anticorps (N-Term)

N° du produit ABIN633344

Détail du produit anti-MECOM anticorps

Antigène: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MECOM est non-conjugé

Application: Western Blotting (WB)

Specificité: EVI1 antibody was raised against the N terminal of EVI1

Purification: Affinity purified

Immunogène: EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EVI1 Blocking Peptide, catalog no. 33R-9619, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MECOM

Antigène: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Autre désignation: EVI1 (MECOM Produits)

Synonymes: anticorps AML1-EVI-1, anticorps EVI1, anticorps MDS1, anticorps MDS1-EVI1, anticorps PRDM3, anticorps D630039M04Rik, anticorps Evi-1, anticorps Evi1, anticorps Jbo, anticorps Mds, anticorps Mds1, anticorps Mds1-Evi1, anticorps Prdm3, anticorps Znfpr1b1, anticorps evi1, anticorps im:7140716, anticorps prdm3, anticorps evi-1, anticorps mecom, anticorps mecom-a, anticorps mecom-b, anticorps xEvi-1, anticorps evi1-B, anticorps MDS1 and EVI1 complex locus, anticorps MDS1 and EVI1 complex locus L homeolog, anticorps MDS1 and EVI1 complex locus S homeolog, anticorps MECOM, anticorps Mecom, anticorps mecom, anticorps mecom.L, anticorps mecom.S

Sujet: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Poids moléculaire: 118 kDa (MW of target protein)