MECOM anticorps (N-Term)

N° du produit ABIN633344

L’anticorps anti-MECOM Polyclonal Lapin est utilisé pour la détection de MECOM dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour MECOM anticorps (N-Term) (ABIN633344)

Antigène: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MECOM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MECOM anticorps

Épitope: N-Term

Specificité: EVI1 antibody was raised against the N terminal of EVI1

Purification: Affinity purified

Immunogène: EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EVI1 Blocking Peptide, (ABIN5613418), is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MECOM

Antigène: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Autre désignation: EVI1

Sujet: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Poids moléculaire: 118 kDa (MW of target protein)