SRP54 anticorps (Middle Region)

N° du produit ABIN633422

L’anticorps Lapin Polyclonal anti-SRP54 a été validé pour WB. Il convient pour détecter SRP54 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour SRP54 anticorps (Middle Region) (ABIN633422)

Antigène: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRP54 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SRP54 anticorps

Épitope: Middle Region

Specificité: SRP54 antibody was raised against the middle region of SRP54

Purification: Affinity purified

Immunogène: SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRP54 Blocking Peptide, (ABIN937989), is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRP54

Antigène: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Autre désignation: SRP54

Sujet: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome