CELF1 anticorps (N-Term)

N° du produit ABIN633435

Détail du produit anti-CELF1 anticorps

Antigène: CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CUGBP1 antibody was raised against the N terminal of CUGBP1

Purification: Affinity purified

Immunogène: CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUGBP1 Blocking Peptide, catalog no. 33R-1032, is also available for use as a blocking control in assays to test for specificity of this CUGBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF1

Antigène: CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))

Autre désignation: CUGBP1 (CELF1 Produits)

Synonymes: anticorps CUGBP1, anticorps BRUNOL2, anticorps CUG-BP, anticorps CUGBP, anticorps EDEN-BP, anticorps NAB50, anticorps NAPOR, anticorps hNab50, anticorps 1600010O03Rik, anticorps AA407467, anticorps Brunol2, anticorps CUG-BP1, anticorps Cugbp1, anticorps D2Wsu101e, anticorps HNAB50, anticorps Bruno-like, anticorps brul, anticorps cb920, anticorps cugbp1, anticorps brunol2, anticorps cug-bp, anticorps cug-bp1, anticorps cugbp, anticorps cugbp1-a, anticorps eden-bp, anticorps edenbp, anticorps nab50, anticorps CUGBP Elav-like family member 1, anticorps CUGBP, Elav-like family member 1, anticorps cugbp, Elav-like family member 1, anticorps CUGBP Elav-like family member 1 L homeolog, anticorps CELF1, anticorps Celf1, anticorps celf1, anticorps celf1.L

Sujet: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization