CELF2 anticorps (N-Term)

N° du produit ABIN633459

Cet anticorps anti-CELF2 est un anticorps Lapin Polyclonal détectant CELF2 dans WB. Adapté pour Humain.

Aperçu rapide pour CELF2 anticorps (N-Term) (ABIN633459)

Antigène: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CELF2 anticorps

Épitope: N-Term

Specificité: CUGBP2 antibody was raised against the N terminal of CUGBP2

Purification: Affinity purified

Immunogène: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUGBP2 Blocking Peptide, (ABIN5613033), is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF2

Antigène: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Autre désignation: CUGBP2

Sujet: CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization