CELF2 anticorps (N-Term)
-
- Antigène Voir toutes CELF2 Anticorps
- CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CELF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CUGBP2 antibody was raised against the N terminal of CUGBP2
- Purification
- Affinity purified
- Immunogène
- CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids TSAFKLDFLPDMMVEGRLLVPDRINGTANKMNGALDHSDQPDPDAIKMFV
- Top Product
- Discover our top product CELF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CUGBP2 Blocking Peptide, catalog no. 33R-9274, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))
- Autre désignation
- CUGBP2 (CELF2 Produits)
- Synonymes
- anticorps CUGBP2, anticorps BRUNOL3, anticorps ETR-3, anticorps ETR3, anticorps NAPOR, anticorps B230218O03, anticorps B230345P09Rik, anticorps C88023, anticorps CELF-2, anticorps CUG-BP2, anticorps Cugbp2, anticorps D230046B21Rik, anticorps Etr-3, anticorps Napor, anticorps Napor-2, anticorps mETR-3, anticorps cb906, anticorps cugbp2, anticorps fj87b07, anticorps wu:fj87b07, anticorps brunol3, anticorps celf2, anticorps cugbp2-a, anticorps etr3, anticorps napor, anticorps Brunol3, anticorps Etr3, anticorps CUGBP Elav-like family member 2, anticorps CUGBP, Elav-like family member 2, anticorps cugbp, Elav-like family member 2, anticorps CUGBP, Elav-like family member 2 L homeolog, anticorps CELF2, anticorps Celf2, anticorps celf2, anticorps celf2.L
- Sujet
- CUGBP2 is a member of the CELF/BRUNOL protein family, which contains two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of CUGBP2 family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. If alternative splicing were to result, multiple transcript variants encoding different isoforms would appear.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-