EIF2S1 anticorps (N-Term)

N° du produit ABIN633461

L’anticorps anti-EIF2S1 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de EIF2S1 dans des échantillons provenant de Humain, Souris, Rat et Drosophila melanogaster. }

Aperçu rapide pour EIF2S1 anticorps (N-Term) (ABIN633461)

Antigène: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2S1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EIF2S1 anticorps

Épitope: N-Term

Specificité: EIF2 S1 antibody was raised against the N terminal of EIF2 1

Purification: Affinity purified

Immunogène: EIF2 S1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2S1 Blocking Peptide, (ABIN5613327), is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2S1

Antigène: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Autre désignation: EIF2S1

Sujet: The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C