EIF2S1 anticorps (N-Term)
-
- Antigène Voir toutes EIF2S1 Anticorps
- EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Drosophila melanogaster
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF2S1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF2 S1 antibody was raised against the N terminal of EIF2 1
- Purification
- Affinity purified
- Immunogène
- EIF2 S1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
- Top Product
- Discover our top product EIF2S1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF2S1 Blocking Peptide, catalog no. 33R-9903, is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))
- Autre désignation
- EIF2S1 (EIF2S1 Produits)
- Synonymes
- anticorps EIF-2, anticorps EIF-2A, anticorps EIF-2alpha, anticorps EIF2, anticorps EIF2A, anticorps Eif2s1, anticorps eif2s1l, anticorps fb36a08, anticorps wu:fb36a08, anticorps zgc:56510, anticorps 0910001O23Rik, anticorps 2410026C18Rik, anticorps 35kDa, anticorps Eif2a, anticorps eIF2alpha, anticorps eif2a, anticorps CG9946, anticorps Dmel\\CG9946, anticorps Eif2alpha, anticorps IF2A_DROME, anticorps M(1)14C, anticorps M(1)19-153, anticorps M(1)8e3-10, anticorps deIF2alpha, anticorps eIF-2, anticorps eIF-2 a, anticorps eIF-2 alpha, anticorps eIF2 alpha, anticorps eIF2-alpha, anticorps eIF2a, anticorps eiF-2alpha, anticorps elF2alpha, anticorps l(1)14Cf, anticorps l(1)19-153, anticorps eukaryotic translation initiation factor 2 subunit alpha, anticorps eukaryotic translation initiation factor 2, subunit 1 alpha a, anticorps eukaryotic translation initiation factor 2, subunit 1 alpha, anticorps eukaryotic translation initiation factor 2 alpha subunit, anticorps Eukaryotic translation initiation factor 2 subunit 1, anticorps eukaryotic translation initiation factor 2 subunit alpha L homeolog, anticorps eukaryotic translation Initiation Factor 2alpha, anticorps EIF2S1, anticorps eif2s1a, anticorps Eif2s1, anticorps eif2s1, anticorps LOC693063, anticorps CNI00230, anticorps THAPSDRAFT_105, anticorps if2a, anticorps eif2s1.L, anticorps eIF-2alpha
- Sujet
- The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C
-