PAIP1 anticorps

N° du produit ABIN633480

Cet anticorps anti-PAIP1 Polyclonal Lapin (ABIN633480) détecte spécifiquement PAIP1 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour PAIP1 anticorps (ABIN633480)

Antigène: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAIP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAIP1 anticorps

Purification: Affinity purified

Immunogène: PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAIP1 Blocking Peptide, (ABIN5615194), is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAIP1

Antigène: PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))

Autre désignation: PAIP1

Sujet: PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.

Poids moléculaire: 46 kDa (MW of target protein)