PAIP1 anticorps
-
- Antigène Voir toutes PAIP1 Anticorps
- PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAIP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS
- Top Product
- Discover our top product PAIP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAIP1 Blocking Peptide, catalog no. 33R-6406, is also available for use as a blocking control in assays to test for specificity of this PAIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAIP1 (Poly(A) Binding Protein Interacting Protein 1 (PAIP1))
- Autre désignation
- PAIP1 (PAIP1 Produits)
- Synonymes
- anticorps fb53g01, anticorps zgc:91954, anticorps wu:fb53g01, anticorps poly(A) binding protein interacting protein 1, anticorps polyadenylate binding protein-interacting protein 1, anticorps poly(A) binding protein interacting protein 1 S homeolog, anticorps PAIP1, anticorps paip1, anticorps Paip1, anticorps paip1.S
- Sujet
- PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.
- Poids moléculaire
- 46 kDa (MW of target protein)
-