IGF2BP1 anticorps (N-Term)

N° du produit ABIN633481

Détail du produit anti-IGF2BP1 anticorps

Antigène: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGF2BP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGF2 BP1 antibody was raised against the N terminal of IGF2 P1

Purification: Affinity purified

Immunogène: IGF2 BP1 antibody was raised using the N terminal of IGF2 P1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGF2BP1 Blocking Peptide, catalog no. 33R-7007, is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGF2BP1

Antigène: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Autre désignation: IGF2BP1 (IGF2BP1 Produits)

Synonymes: anticorps IGF2BP1, anticorps ZBP1, anticorps CRD-BP, anticorps CRDBP, anticorps IMP-1, anticorps IMP1, anticorps VICKZ1, anticorps AL024068, anticorps AW549074, anticorps Crdbp, anticorps D030026A21Rik, anticorps D11Moh40e, anticorps D11Moh45, anticorps Neilsen, anticorps Zbp1, anticorps Imp1, anticorps wu:fi72a06, anticorps zgc:152963, anticorps insulin like growth factor 2 mRNA binding protein 1, anticorps insulin-like growth factor 2 mRNA binding protein 1, anticorps IGF2BP1, anticorps Igf2bp1, anticorps igf2bp1

Sujet: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.

Poids moléculaire: 63 kDa (MW of target protein)