RBM38 anticorps (Middle Region)

N° du produit ABIN633488

L’anticorps Lapin Polyclonal anti-RBM38 a été validé pour WB. Il convient pour détecter RBM38 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RBM38 anticorps (Middle Region) (ABIN633488)

Antigène: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM38 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBM38 anticorps

Épitope: Middle Region

Specificité: RBM38 antibody was raised against the middle region of RBM38

Purification: Affinity purified

Immunogène: RBM38 antibody was raised using the middle region of RBM38 corresponding to a region with amino acids QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM38 Blocking Peptide, (ABIN5615791), is also available for use as a blocking control in assays to test for specificity of this RBM38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM38

Antigène: RBM38 (RNA Binding Motif Protein 38 (RBM38))

Autre désignation: RBM38

Sujet: RBM38 is a probable RNA-binding protein.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development