IREB2 anticorps (Middle Region)

N° du produit ABIN633564

Détail du produit anti-IREB2 anticorps

Antigène: IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IREB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: IREB2 antibody was raised against the middle region of IREB2

Purification: Affinity purified

Immunogène: IREB2 antibody was raised using the middle region of IREB2 corresponding to a region with amino acids IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IREB2 Blocking Peptide, catalog no. 33R-4113, is also available for use as a blocking control in assays to test for specificity of this IREB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IREB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IREB2

Antigène: IREB2 (Iron-Responsive Element Binding Protein 2 (IREB2))

Autre désignation: IREB2 (IREB2 Produits)

Synonymes: anticorps IREB2, anticorps im:7153062, anticorps DKFZp468N047, anticorps D9Ertd85e, anticorps Irp2, anticorps ACO3, anticorps IRP2, anticorps IRP2AD, anticorps IREBP2, anticorps iron responsive element binding protein 2, anticorps iron-responsive element binding protein 2, anticorps iron responsive element binding protein 2 L homeolog, anticorps IREB2, anticorps ireb2, anticorps Ireb2, anticorps ireb2.L

Sujet: IREB2 binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. IREB2 binds to the IRE element in ferritin which results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA.

Poids moléculaire: 105 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis