Aconitase 1 anticorps (N-Term)

N° du produit ABIN633567

Cet anticorps anti-Aconitase 1 est un anticorps Lapin Polyclonal détectant Aconitase 1 dans WB et IHC. Adapté pour Humain et Rat.

Aperçu rapide pour Aconitase 1 anticorps (N-Term) (ABIN633567)

Antigène: Aconitase 1 (ACO1)

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aconitase 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Aconitase 1 anticorps

Épitope: N-Term

Specificité: ACO1 antibody was raised against the N terminal of ACO1

Purification: Affinity purified

Immunogène: ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACO1 Blocking Peptide, (ABIN5611903), is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Aconitase 1

Antigène: Aconitase 1 (ACO1)

Autre désignation: ACO1

Sujet: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis