Aconitase 1 anticorps (N-Term)
-
- Antigène Voir toutes Aconitase 1 (ACO1) Anticorps
- Aconitase 1 (ACO1)
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Aconitase 1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ACO1 antibody was raised against the N terminal of ACO1
- Purification
- Affinity purified
- Immunogène
- ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
- Top Product
- Discover our top product ACO1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACO1 Blocking Peptide, catalog no. 33R-6475, is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Aconitase 1 (ACO1)
- Autre désignation
- ACO1 (ACO1 Produits)
- Synonymes
- anticorps ACONS, anticorps IREB1, anticorps IREBP, anticorps IREBP1, anticorps IRP1, anticorps Acon1, anticorps Ratireb, anticorps ratireb, anticorps Aco1, anticorps AI256519, anticorps Aco-1, anticorps Irebp, anticorps Irp1, anticorps aconitase 1, anticorps aconitase 1, soluble, anticorps aconitase 1 L homeolog, anticorps ACO1, anticorps Aco1, anticorps aco1.L
- Sujet
- ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.
- Poids moléculaire
- 98 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-