HNRNPM anticorps (N-Term)

N° du produit ABIN633571

Cet anticorps Lapin Polyclonal détecte spécifiquement HNRNPM dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour HNRNPM anticorps (N-Term) (ABIN633571)

Antigène: HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HNRNPM anticorps

Épitope: N-Term

Specificité: HNRPM antibody was raised against the N terminal Of Hnrpm

Purification: Affinity purified

Immunogène: HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPM Blocking Peptide, (ABIN936940), is also available for use as a blocking control in assays to test for specificity of this HNRPM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPM

Antigène: HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M (HNRNPM))

Autre désignation: HNRPM

Sujet: HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Poids moléculaire: 73 kDa (MW of target protein)