STAU1/Staufen anticorps

N° du produit ABIN633583

Cet anticorps Lapin Polyclonal détecte spécifiquement STAU1/Staufen dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour STAU1/Staufen anticorps (ABIN633583)

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STAU1/Staufen est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STAU1/Staufen anticorps

Purification: Affinity purified

Immunogène: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STAU1 Blocking Peptide, (ABIN5616431), is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STAU1/Staufen

Antigène: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Autre désignation: STAU1

Sujet: STAU1(Staufen) is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Asymmetric Protein Localization