SFRS7 anticorps (Middle Region)

N° du produit ABIN633591

Détail du produit anti-SFRS7 anticorps

Antigène: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS7 est non-conjugé

Application: Western Blotting (WB)

Specificité: SFRS7 antibody was raised against the middle region of SFRS7

Purification: Affinity purified

Immunogène: SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS7 Blocking Peptide, catalog no. 33R-8776, is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS7

Antigène: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Autre désignation: SFRS7 (SFRS7 Produits)

Synonymes: anticorps 9G8, anticorps AAG3, anticorps SFRS7, anticorps 35kDa, anticorps 9430065L19Rik, anticorps NX-96, anticorps Sfrs7, anticorps 9g8, anticorps aag3, anticorps sfrs7, anticorps srsf7, anticorps zgc:114203, anticorps serine and arginine rich splicing factor 7, anticorps serine/arginine-rich splicing factor 7, anticorps serine/arginine-rich splicing factor 7 L homeolog, anticorps serine/arginine-rich splicing factor 7b, anticorps SRSF7, anticorps Srsf7, anticorps srsf7.L, anticorps srsf7b

Sujet: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Poids moléculaire: 27 kDa (MW of target protein)