SFRS7 anticorps (Middle Region)

N° du produit ABIN633591

Cet anticorps anti-SFRS7 Polyclonal Lapin (ABIN633591) détecte spécifiquement SFRS7 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SFRS7 anticorps (Middle Region) (ABIN633591)

Antigène: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SFRS7 anticorps

Épitope: Middle Region

Specificité: SFRS7 antibody was raised against the middle region of SFRS7

Purification: Affinity purified

Immunogène: SFRS7 antibody was raised using the middle region of SFRS7 corresponding to a region with amino acids SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS7 Blocking Peptide, (ABIN5616104), is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS7

Antigène: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Autre désignation: SFRS7

Sujet: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Poids moléculaire: 27 kDa (MW of target protein)