RNASET2 anticorps (Middle Region)

N° du produit ABIN633593

L’anticorps Lapin Polyclonal anti-RNASET2 a été validé pour WB. Il convient pour détecter RNASET2 dans des échantillons de Humain.

Aperçu rapide pour RNASET2 anticorps (Middle Region) (ABIN633593)

Antigène: RNASET2 (Ribonuclease T2 (RNASET2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNASET2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNASET2 anticorps

Épitope: Middle Region

Specificité: RNASET2 antibody was raised against the middle region of RNASET2

Purification: Affinity purified

Immunogène: RNASET2 antibody was raised using the middle region of RNASET2 corresponding to a region with amino acids RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASET2 Blocking Peptide, (ABIN5615882), is also available for use as a blocking control in assays to test for specificity of this RNASET2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASET2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNASET2

Antigène: RNASET2 (Ribonuclease T2 (RNASET2))

Autre désignation: RNASET2

Sujet: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement.

Poids moléculaire: 29 kDa (MW of target protein)